PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10000598m
Common NameEUTSA_v10000598mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 209aa    MW: 23824.3 Da    PI: 10.1632
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10000598mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.74.1e-251059251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     ri++++ rqvtfskRr+g++KKA+EL +LCdae+ +iifs+t+kly+++s
  Thhalv10000598m 10 RINDSTSRQVTFSKRRKGLIKKAKELAILCDAEIGLIIFSNTDKLYDFAS 59
                     8***********************************************86 PP

2K-box77.14.6e-2676164492
            K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                      +++ s+ +++ + +q+e++ L++e+++Lq ++R+l+G++L+ Ls+keL  +e+qLe sl+ iR kK+++l+++i+e+ +k + +++en 
  Thhalv10000598m  76 QQQLSNPASEVKFWQTEVTTLRQELHSLQDNHRQLMGQQLNGLSVKELITIESQLEMSLRGIRMKKEQILTNEIKEQTRKRNIIHHENL 164
                      34445778999******************************************************************999999999985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.927161IPR002100Transcription factor, MADS-box
CDDcd002651.51E-38278No hitNo description
SuperFamilySSF554553.4E-30289IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003199.9E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-253859IPR002100Transcription factor, MADS-box
PfamPF014868.9E-2383163IPR002487Transcription factor, K-box
PROSITE profilePS5129713.01486200IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MGRGKIVIQR INDSTSRQVT FSKRRKGLIK KAKELAILCD AEIGLIIFSN TDKLYDFASS  60
SMKSAIERFN KTKMEQQQLS NPASEVKFWQ TEVTTLRQEL HSLQDNHRQL MGQQLNGLSV  120
KELITIESQL EMSLRGIRMK KEQILTNEIK EQTRKRNIIH HENLAYAASS TNGMGLRELE  180
DAADESHAQV RLQLSQPEQP LYKIPSKS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A4e-19269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B4e-19269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C4e-19269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D4e-19269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A6e-19269168Myocyte-specific enhancer factor 2A
3kov_B6e-19269168Myocyte-specific enhancer factor 2A
3kov_I6e-19269168Myocyte-specific enhancer factor 2A
3kov_J6e-19269168Myocyte-specific enhancer factor 2A
3p57_A6e-19269168Myocyte-specific enhancer factor 2A
3p57_B6e-19269168Myocyte-specific enhancer factor 2A
3p57_C6e-19269168Myocyte-specific enhancer factor 2A
3p57_D6e-19269168Myocyte-specific enhancer factor 2A
3p57_I6e-19269168Myocyte-specific enhancer factor 2A
3p57_J6e-19269168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935581e-153AB493558.1 Arabidopsis thaliana At2g22630 mRNA for hypothetical protein, partial cds, clone: RAAt2g22630.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006404725.11e-153hypothetical protein EUTSA_v10000598mg
SwissprotQ388401e-117AGL17_ARATH; Agamous-like MADS-box protein AGL17
TrEMBLV4M1U11e-153V4M1U1_EUTSA; Uncharacterized protein
STRINGBra039921.1-P1e-122(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53024105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22630.11e-119AGAMOUS-like 17